DUS1L Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUS1L

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like

Protein Size: 473

Purification: Affinity Purified

• SKU: AVIARP57616_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57616_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64118
• Host: Rabbit