DUSP5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUSP5

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dual specificity protein phosphatase 5

Protein Size: 384

Purification: Affinity Purified

• SKU: AVIARP58226_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58226_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1847
• Host: Rabbit