Eapp Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Eapp

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: PALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSEDEFEKEMEAELNS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eapp protein EMBL AAI68880.1

Protein Size: 280

Purification: Affinity Purified

• SKU: AVIARP57255_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57255_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 299043
• Host: Rabbit