EEA1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EEA1 is involved in neuronal synaptic vesicle function and axonal transport and growth. EEA1 may undergo calcium-dependent conformational changes that are required for binding to SNAP-25.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EEA1

Key Reference: Selak,S., (2006) Neuroscience 143 (4), 953-964

Molecular Weight: 162kDa

Peptide Sequence: Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Early endosome antigen 1

Protein Size: 1411

Purification: Affinity Purified

• SKU: AVIARP58125_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58125_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 8411
• Host: Rabbit