EEF2 Antibody - N-terminal region : FITC

EEF2 Antibody - N-terminal region : FITC
SKU
AVIARP58457_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EEF2

Key Reference: Tu,L.C., (2007) Mol. Cell Proteomics 6 (4), 575-588

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongation factor 2

Protein Size: 858

Purification: Affinity Purified
More Information
SKU AVIARP58457_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58457_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 1938
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×