EFEMP2 Antibody - middle region : Biotin

EFEMP2 Antibody - middle region : Biotin
SKU
AVIARP55351_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP2

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EGF-containing fibulin-like extracellular matrix protein 2

Protein Size: 443

Purification: Affinity Purified
More Information
SKU AVIARP55351_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55351_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30008
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×