EFHA2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing family member A2

Protein Size: 530

Purification: Affinity Purified

• SKU: AVIARP55801_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55801_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 286097
• Host: Rabbit