EFHA2 Antibody - N-terminal region : HRP

EFHA2 Antibody - N-terminal region : HRP
SKU
AVIARP55801_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EF-hand domain-containing family member A2

Protein Size: 530

Purification: Affinity Purified
More Information
SKU AVIARP55801_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55801_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286097
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×