EGR1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a tr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EGR1

Key Reference: Akutagawa,O., (2008) Cancer Sci. 99 (7), 1401-1406

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Early growth response protein 1

Protein Size: 543

Purification: Affinity Purified

• SKU: AVIARP58382_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58382_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1958
• Host: Rabbit