EHD4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EHD4

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EH domain-containing protein 4

Protein Size: 541

Purification: Affinity Purified

• SKU: AVIARP55432_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55432_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 30844
• Host: Rabbit