EIF2C1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C1

Key Reference: Eulalio,A., (2008) Nat. Struct. Mol. Biol. 15 (4), 346-353

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-1

Protein Size: 857

Purification: Affinity Purified

• SKU: AVIARP54863_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54863_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26523
• Host: Rabbit