EIF2C3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C3

Key Reference: Sasaki,T., (2003) Genomics 82 (3), 323-330

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-3

Protein Size: 626

Purification: Affinity Purified

• SKU: AVIARP58813_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58813_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 192669
• Host: Rabbit
• Conjugate: Conjugated, Biotin