Eif2c3 Antibody - N-terminal region : FITC

Eif2c3 Antibody - N-terminal region : FITC
SKU
AVIARP58812_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Eif2c3 is required for RNA-mediated gene silencing (RNAi). It binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. It lacks endonuclease activity and does not appear to cleave target mRNAs.

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-3

Protein Size: 860

Purification: Affinity Purified
More Information
SKU AVIARP58812_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58812_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 214150
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×