Eif2c3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Eif2c3 is required for RNA-mediated gene silencing (RNAi). It binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. It lacks endonuclease activity and does not appear to cleave target mRNAs.

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-3

Protein Size: 860

Purification: Affinity Purified

• SKU: AVIARP58812_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58812_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 214150
• Host: Rabbit