Eif2c3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Eif2c3 is required for RNA-mediated gene silencing (RNAi). It binds to short RNAs such as microRNAs (miRNAs) and represses the translation of mRNAs which are complementary to them. It lacks endonuclease activity and does not appear to cleave target mRNAs.

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein argonaute-3

Protein Size: 860

Purification: Affinity Purified

• SKU: AVIARP58812_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58812_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 214150
• Host: Rabbit