EIF2C3 Antibody - N-terminal region : HRP

EIF2C3 Antibody - N-terminal region : HRP
SKU
AVIARP58813_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2C3

Key Reference: Sasaki,T., (2003) Genomics 82 (3), 323-330

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein argonaute-3

Protein Size: 626

Purification: Affinity Purified
More Information
SKU AVIARP58813_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58813_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 192669
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×