EIF2C4 Antibody - middle region : Biotin

EIF2C4 Antibody - middle region : Biotin
SKU
AVIARP58795_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF2C4

Key Reference: Tao,W.A., (2005) Nat. Methods 2 (8), 591-598

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein argonaute-4

Protein Size: 861

Purification: Affinity Purified
More Information
SKU AVIARP58795_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58795_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 192670
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×