EIF4E2 Antibody - N-terminal region : Biotin

EIF4E2 Antibody - N-terminal region : Biotin
SKU
AVIARP58897_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E type 2

Protein Size: 245

Purification: Affinity Purified
More Information
SKU AVIARP58897_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58897_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9470
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×