EIF4E2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: YTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Eukaryotic translation initiation factor 4E type 2

Protein Size: 245

Purification: Affinity Purified

• SKU: AVIARP58898_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58898_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9470
• Host: Rabbit
• Conjugate: Conjugated, HRP