ELMOD1 Antibody - middle region : HRP

ELMOD1 Antibody - middle region : HRP
SKU
AVIARP57287_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of ELMOD1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELMOD1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: CYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ELMO domain-containing protein 1

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP57287_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57287_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55531
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×