ELMOD1 Antibody - N-terminal region : HRP

ELMOD1 Antibody - N-terminal region : HRP
SKU
AVIARP57288_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ELMOD1 acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELMOD1

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ELMO domain-containing protein 1

Protein Size: 190

Purification: Affinity Purified
More Information
SKU AVIARP57288_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57288_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55531
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×