EML3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: EML3 may modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EML3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Echinoderm microtubule-associated protein-like 3

Protein Size: 896

Purification: Affinity Purified

• SKU: AVIARP55579_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55579_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 256364
• Host: Rabbit