ENDOV Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: A730011L01Rik selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endonuclease V

Protein Size: 338

Purification: Affinity Purified

• SKU: AVIARP55675_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55675_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 338371
• Host: Rabbit