ENDOV Antibody - middle region : HRP

ENDOV Antibody - middle region : HRP
SKU
AVIARP55675_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: A730011L01Rik selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endonuclease V

Protein Size: 338

Purification: Affinity Purified
More Information
SKU AVIARP55675_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55675_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 338371
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×