ENOSF1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1

Key Reference: Giusti,B., (er) Biochem. Genet. (2008) In press

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial enolase superfamily member 1

Protein Size: 443

Purification: Affinity Purified

• SKU: AVIARP56963_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56963_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55556
• Host: Rabbit