EPB41L2 Antibody - middle region : FITC

EPB41L2 Antibody - middle region : FITC
SKU
AVIARP54569_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Band 4.1-like protein 2

Protein Size: 603

Purification: Affinity Purified
More Information
SKU AVIARP54569_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54569_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2037
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×