EPB41L2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Band 4.1-like protein 2

Protein Size: 603

Purification: Affinity Purified

• SKU: AVIARP54569_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54569_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2037
• Host: Rabbit