EPC2 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: EPC2 may play a role in transcription or DNA repair.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPC2

Key Reference: N/A

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: TSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Enhancer of polycomb homolog 2

Protein Size: 807

Purification: Affinity purified

• SKU: AVIARP55311_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55311_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26122
• Host: Rabbit