EPHX4 Antibody - C-terminal region : Biotin

EPHX4 Antibody - C-terminal region : Biotin
SKU
AVIARP55652_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHX4

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: QLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLLWG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified
More Information
SKU AVIARP55652_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55652_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253152
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×