EPS8 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPS8

Key Reference: Welsch,T., (2007) Cancer Lett. 255 (2), 205-218

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epidermal growth factor receptor kinase substrate 8

Protein Size: 822

Purification: Affinity Purified

• SKU: AVIARP54726_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54726_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2059
• Host: Rabbit