ERAS Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERAS

Key Reference: Miyamoto,S., (2008) Carcinogenesis 29 (2), 418-426

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTPase ERas

Protein Size: 233

Purification: Affinity Purified

• SKU: AVIARP55794_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55794_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3266
• Host: Rabbit