Eras Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Eras plays an important role in the tumor-like growth properties of embryonic stem cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase ERas

Protein Size: 227

Purification: Affinity Purified

• SKU: AVIARP55793_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55793_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 353283
• Host: Rabbit