ERCC1 Antibody - N-terminal region : FITC

ERCC1 Antibody - N-terminal region : FITC
SKU
AVIARP55941_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ERCC1

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-1

Protein Size: 213

Purification: Affinity Purified
More Information
SKU AVIARP55941_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55941_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2067
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×