ERCC4 Antibody - middle region : FITC

ERCC4 Antibody - middle region : FITC
SKU
AVIARP58272_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC4

Molecular Weight: 101kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair endonuclease XPF

Protein Size: 916

Purification: Affinity Purified
More Information
SKU AVIARP58272_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58272_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2072
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×