ERCC4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC4

Molecular Weight: 101kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA repair endonuclease XPF

Protein Size: 916

Purification: Affinity Purified

• SKU: AVIARP58272_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58272_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2072
• Host: Rabbit