ERCC6L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC6L

Molecular Weight: 141kDa

Peptide Sequence: Synthetic peptide located within the following region: GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-6-like

Protein Size: 1250

Purification: Affinity Purified

• SKU: AVIARP56997_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56997_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54821
• Host: Rabbit