ERCC8 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ERCC8 is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC8

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA excision repair protein ERCC-8

Protein Size: 396

Purification: Affinity Purified

• SKU: AVIARP58571_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58571_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 1161
• Host: Rabbit
• Conjugate: Conjugated, FITC