ERG Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: v-ets erythroblastosis virus E26 oncogene like isoform 2 (ERG) is a transcriptional regulator. It may participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERG

Key Reference: Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: IMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcriptional regulator ERG

Protein Size: 462

Purification: Affinity Purified

• SKU: AVIARP57967_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57967_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2078
• Host: Rabbit