ESD Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ESD is a serine hydrolase involved in the detoxification of formaldehyde.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESD

Key Reference: Dunham,A., (2004) Nature 428 (6982), 522-528

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: S-formylglutathione hydrolase

Protein Size: 282

Purification: Affinity Purified

• SKU: AVIARP58619_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58619_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2098
• Host: Rabbit