EXOC1 Antibody - N-terminal region : Biotin

EXOC1 Antibody - N-terminal region : Biotin
SKU
AVIARP57770_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC1

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: NVSSQLLEESVPSGENQSVTGGDEEVVDEYQELNAREEQDIEIMMEGCEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Exocyst complex component 1

Protein Size: 879

Purification: Affinity Purified
More Information
SKU AVIARP57770_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57770_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55763
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×