EXOC4 Antibody - N-terminal region : Biotin

EXOC4 Antibody - N-terminal region : Biotin
SKU
AVIARP56253_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC4

Key Reference: Pohl,C. (2008) Cell 132 (5), 832-845

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EXOC4 protein EMBL AAH26174.1

Protein Size: 473

Purification: Affinity Purified
More Information
SKU AVIARP56253_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56253_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 60412
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×