EXOC6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EXOC6

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Exocyst complex component 6

Protein Size: 804

Purification: Affinity Purified

• SKU: AVIARP57320_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57320_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54536
• Host: Rabbit