EXOC6 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC6

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ46316 fis, clone TESTI4041482, highly similar to Exocyst complex component 6 EMBL BAG54647.1

Protein Size: 799

Purification: Affinity Purified

• SKU: AVIARP57319_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57319_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54536
• Host: Rabbit