FAIM Antibody - N-terminal region : HRP

FAIM Antibody - N-terminal region : HRP
SKU
AVIARP56237_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM

Key Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fas apoptotic inhibitory molecule 1

Protein Size: 213

Purification: Affinity Purified
More Information
SKU AVIARP56237_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56237_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 55179
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×