FAM131C Antibody - middle region : HRP

FAM131C Antibody - middle region : HRP
SKU
AVIARP55838_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM131C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM131C

Protein Size: 280

Purification: Affinity Purified
More Information
SKU AVIARP55838_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55838_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 348487
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×