FAM29A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM29A

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HAUS augmin-like complex subunit 6

Protein Size: 955

Purification: Affinity Purified

Subunit: 6

• SKU: AVIARP56990_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56990_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54801
• Host: Rabbit