FAM45BP Antibody - middle region : Biotin

FAM45BP Antibody - middle region : Biotin
SKU
AVIARP57263_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM45B

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 357

Purification: Affinity Purified
More Information
SKU AVIARP57263_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57263_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55855
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×