FAM80A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of FAM80A is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM80A

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acetylaspartyl-glutamate synthetase A

Protein Size: 350

Purification: Affinity Purified

• SKU: AVIARP55677_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55677_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284716
• Host: Rabbit