FAM98B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of FAM98B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM98B

Key Reference: Tsuritani,K., (2007) Genome Res. 17 (7), 1005-1014

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM98B Ensembl ENSP00000380734

Protein Size: 433

Purification: Affinity Purified

• SKU: AVIARP55663_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55663_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 283742
• Host: Rabbit