FANCL Antibody - middle region : Biotin

FANCL Antibody - middle region : Biotin
SKU
AVIARP56321_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FANCL

Key Reference: Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase FANCL

Protein Size: 380

Purification: Affinity Purified
More Information
SKU AVIARP56321_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56321_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 55120
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×