FAS Antibody - N-terminal region : FITC

FAS Antibody - N-terminal region : FITC
SKU
AVIARP59115_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAS

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tumor necrosis factor receptor superfamily member 6

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP59115_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59115_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Goat (Caprine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 355
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×